Lineage for d1l2ka_ (1l2k A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148845Protein Myoglobin [46469] (9 species)
  7. 148912Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)
  8. 148929Domain d1l2ka_: 1l2k A: [73507]

Details for d1l2ka_

PDB Entry: 1l2k (more details), 1.5 Å

PDB Description: Neutron Structure Determination of Sperm Whale Met-Myoglobin at 1.5A Resolution.

SCOP Domain Sequences for d1l2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ka_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy

SCOP Domain Coordinates for d1l2ka_:

Click to download the PDB-style file with coordinates for d1l2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ka_: