Lineage for d1l2ib_ (1l2i B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156240Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 156241Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 156242Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (17 proteins)
  6. 156249Protein Estrogen receptor alpha [48519] (1 species)
  7. 156250Species Human (Homo sapiens) [TaxId:9606] [48520] (9 PDB entries)
  8. 156252Domain d1l2ib_: 1l2i B: [73504]

Details for d1l2ib_

PDB Entry: 1l2i (more details), 1.95 Å

PDB Description: Human Estrogen Receptor alpha Ligand-binding Domain in Complex with (R,R)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol and a Glucocorticoid Receptor Interacting Protein 1 NR box II Peptide

SCOP Domain Sequences for d1l2ib_:

Sequence, based on SEQRES records: (download)

>d1l2ib_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dah

Sequence, based on observed residues (ATOM records): (download)

>d1l2ib_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens)}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytkdhihrvldkitdtlihlmakagl
tlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldah

SCOP Domain Coordinates for d1l2ib_:

Click to download the PDB-style file with coordinates for d1l2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l2ia_