Lineage for d1l2ba_ (1l2b A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 201031Fold e.14: DNA repair protein MutM (Fpg) [56735] (1 superfamily)
  4. 201032Superfamily e.14.1: DNA repair protein MutM (Fpg) [56736] (1 family) (S)
  5. 201033Family e.14.1.1: DNA repair protein MutM (Fpg) [56737] (1 protein)
  6. 201034Protein DNA repair protein MutM (Fpg) [56738] (2 species)
  7. 201042Species Thermus thermophilus [TaxId:274] [56739] (6 PDB entries)
  8. 201049Domain d1l2ba_: 1l2b A: [73499]

Details for d1l2ba_

PDB Entry: 1l2b (more details), 2.4 Å

PDB Description: MutM (Fpg) DNA End-Product Structure

SCOP Domain Sequences for d1l2ba_:

Sequence, based on SEQRES records: (download)

>d1l2ba_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Thermus thermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
ygrqgnpckrcgtpiektvvagrgthycprcqr

Sequence, based on observed residues (ATOM records): (download)

>d1l2ba_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Thermus thermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvrgtfqhhlyvygrqgnpck
rcgtpiektvvagrgthycprcqr

SCOP Domain Coordinates for d1l2ba_:

Click to download the PDB-style file with coordinates for d1l2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ba_: