Lineage for d1l1za_ (1l1z A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 201031Fold e.14: DNA repair protein MutM (Fpg) [56735] (1 superfamily)
  4. 201032Superfamily e.14.1: DNA repair protein MutM (Fpg) [56736] (1 family) (S)
  5. 201033Family e.14.1.1: DNA repair protein MutM (Fpg) [56737] (1 protein)
  6. 201034Protein DNA repair protein MutM (Fpg) [56738] (2 species)
  7. 201042Species Thermus thermophilus [TaxId:274] [56739] (6 PDB entries)
  8. 201043Domain d1l1za_: 1l1z A: [73492]

Details for d1l1za_

PDB Entry: 1l1z (more details), 1.7 Å

PDB Description: MutM (Fpg) Covalent-DNA Intermediate

SCOP Domain Sequences for d1l1za_:

Sequence, based on SEQRES records: (download)

>d1l1za_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Thermus thermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhlyv
ygrqgnpckrcgtpiektvvagrgthycprcqr

Sequence, based on observed residues (ATOM records): (download)

>d1l1za_ e.14.1.1 (A:) DNA repair protein MutM (Fpg) {Thermus thermophilus}
pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
fragilpgrpaaslsskeierlheemvatigeavmkggstvgtfqhhlyvygrqgnpckr
cgtpiektvvagrgthycprcqr

SCOP Domain Coordinates for d1l1za_:

Click to download the PDB-style file with coordinates for d1l1za_.
(The format of our PDB-style files is described here.)

Timeline for d1l1za_: