Lineage for d1l1ia_ (1l1i A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422942Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423144Superfamily b.80.2: Insect cysteine-rich antifreeze protein [51156] (1 family) (S)
    superhelix turns are made of two short strands each
  5. 2423145Family b.80.2.1: Insect cysteine-rich antifreeze protein [51157] (1 protein)
    this is a repeat family; one repeat unit is 1ezg A:35-47 found in domain
  6. 2423146Protein Insect cysteine-rich antifreeze protein [51158] (1 species)
  7. 2423147Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [51159] (2 PDB entries)
  8. 2423150Domain d1l1ia_: 1l1i A: [73469]

Details for d1l1ia_

PDB Entry: 1l1i (more details)

PDB Description: solution structure of the tenebrio molitor antifreeze protein
PDB Compounds: (A:) Thermal hysteresis protein isoform YL-1 (2-14)

SCOPe Domain Sequences for d1l1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ia_ b.80.2.1 (A:) Insect cysteine-rich antifreeze protein {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
qctggadctsctgactgcgncpnavtctnsqhcvkantctgstdcntaqtctnskdcfea
ntctdstncykatactnssgcpgh

SCOPe Domain Coordinates for d1l1ia_:

Click to download the PDB-style file with coordinates for d1l1ia_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ia_: