Lineage for d1l1ff1 (1l1f F:213-505)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309102Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 309103Protein Glutamate dehydrogenase [51884] (7 species)
  7. 309172Species Human (Homo sapiens) [TaxId:9606] [75115] (2 PDB entries)
  8. 309178Domain d1l1ff1: 1l1f F:213-505 [73466]
    Other proteins in same PDB: d1l1fa2, d1l1fb2, d1l1fc2, d1l1fd2, d1l1fe2, d1l1ff2

Details for d1l1ff1

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form

SCOP Domain Sequences for d1l1ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ff1 c.2.1.7 (F:213-505) Glutamate dehydrogenase {Human (Homo sapiens)}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

SCOP Domain Coordinates for d1l1ff1:

Click to download the PDB-style file with coordinates for d1l1ff1.
(The format of our PDB-style files is described here.)

Timeline for d1l1ff1: