Lineage for d1l1fe2 (1l1f E:10-212)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182880Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 182881Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 182882Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 182883Protein Glutamate dehydrogenase [53225] (7 species)
  7. 182928Species Human (Homo sapiens) [TaxId:9606] [75252] (1 PDB entry)
  8. 182933Domain d1l1fe2: 1l1f E:10-212 [73465]
    Other proteins in same PDB: d1l1fa1, d1l1fb1, d1l1fc1, d1l1fd1, d1l1fe1, d1l1ff1

Details for d1l1fe2

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form

SCOP Domain Sequences for d1l1fe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1fe2 c.58.1.1 (E:10-212) Glutamate dehydrogenase {Human (Homo sapiens)}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1l1fe2:

Click to download the PDB-style file with coordinates for d1l1fe2.
(The format of our PDB-style files is described here.)

Timeline for d1l1fe2: