Lineage for d1l1fe1 (1l1f E:213-505)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106264Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2106265Protein Glutamate dehydrogenase [51884] (8 species)
  7. 2106331Species Human (Homo sapiens) [TaxId:9606] [75115] (2 PDB entries)
  8. 2106336Domain d1l1fe1: 1l1f E:213-505 [73464]
    Other proteins in same PDB: d1l1fa2, d1l1fb2, d1l1fc2, d1l1fd2, d1l1fe2, d1l1ff2

Details for d1l1fe1

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form
PDB Compounds: (E:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d1l1fe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1fe1 c.2.1.7 (E:213-505) Glutamate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsileadcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfkvyneagvtft

SCOPe Domain Coordinates for d1l1fe1:

Click to download the PDB-style file with coordinates for d1l1fe1.
(The format of our PDB-style files is described here.)

Timeline for d1l1fe1: