Lineage for d1l1fc2 (1l1f C:10-212)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1862683Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1862684Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1862685Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1862686Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1862743Species Human (Homo sapiens) [TaxId:9606] [75252] (2 PDB entries)
  8. 1862746Domain d1l1fc2: 1l1f C:10-212 [73461]
    Other proteins in same PDB: d1l1fa1, d1l1fb1, d1l1fc1, d1l1fd1, d1l1fe1, d1l1ff1

Details for d1l1fc2

PDB Entry: 1l1f (more details), 2.7 Å

PDB Description: Structure of human glutamate dehydrogenase-apo form
PDB Compounds: (C:) Glutamate Dehydrogenase 1

SCOPe Domain Sequences for d1l1fc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1fc2 c.58.1.1 (C:10-212) Glutamate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d1l1fc2:

Click to download the PDB-style file with coordinates for d1l1fc2.
(The format of our PDB-style files is described here.)

Timeline for d1l1fc2: