Lineage for d1l1ea_ (1l1e A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 839874Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (6 proteins)
  6. 839897Protein PccA [75269] (1 species)
  7. 839898Species Mycobacterium tuberculosis [TaxId:1773] [75270] (1 PDB entry)
  8. 839899Domain d1l1ea_: 1l1e A: [73454]

Details for d1l1ea_

PDB Entry: 1l1e (more details), 2 Å

PDB Description: Crystal Structure of Mycolic Acid Cyclopropane Synthase PcaA Complexed with S-adenosyl-L-homocysteine
PDB Compounds: (A:) mycolic acid synthase

SCOP Domain Sequences for d1l1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1ea_ c.66.1.18 (A:) PccA {Mycobacterium tuberculosis [TaxId: 1773]}
ydlsddffrlfldptqtyscayferddmtlqeaqiakidlalgklnlepgmtlldigcgw
gatmrraiekydvnvvgltlsenqaghvqkmfdqmdtprsrrvllegwekfdepvdrivs
igafehfghqryhhffevthrtlpadgkmllhtivrptfkegrekgltlthelvhftkfi
laeifpggwlpsiptvheyaekvgfrvtavqslqlhyartldmwataleankdqaiaiqs
qtvydrymkyltgcaklfrqgytdvdqftlek

SCOP Domain Coordinates for d1l1ea_:

Click to download the PDB-style file with coordinates for d1l1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1l1ea_: