Lineage for d1l0yd2 (1l0y D:108-221)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894515Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1894620Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 1894621Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 1894627Domain d1l0yd2: 1l0y D:108-221 [73447]
    Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb1, d1l0yc1, d1l0yc2, d1l0yd1
    complexed with gol, zn

Details for d1l0yd2

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc
PDB Compounds: (D:) exotoxin type a

SCOPe Domain Sequences for d1l0yd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yd2 d.15.6.1 (D:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOPe Domain Coordinates for d1l0yd2:

Click to download the PDB-style file with coordinates for d1l0yd2.
(The format of our PDB-style files is described here.)

Timeline for d1l0yd2: