Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
Domain d1l0yd2: 1l0y D:108-221 [73447] Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb1, d1l0yc1, d1l0yc2, d1l0yd1 complexed with cry, zn; mutant |
PDB Entry: 1l0y (more details), 2.5 Å
SCOP Domain Sequences for d1l0yd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0yd2 d.15.6.1 (D:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk
Timeline for d1l0yd2: