SCOP 1.71: Domain d1l0yd2: 1l0y D:108-221

Lineage for d1l0yd2 (1l0y D:108-221)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)

8. Domain d1l0yd2: 1l0y D:108-221 [73447]
   Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb1, d1l0yc1, d1l0yc2, d1l0yd1
   complexed with cry, zn; mutant

Details for d1l0yd2

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yd2:

Sequence; same for both SEQRES and ATOM records:

>d1l0yd2 d.15.6.1 (D:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

Timeline for d1l0yd2:

• d1l0yd2 first appeared in SCOP 1.61
  
• d1l0yd2 appears in SCOP 1.69
  
• d1l0yd2 appears in SCOP 1.73
  
• d1l0yd2 appears in the current release, SCOPe 2.08