SCOP 1.63: Domain d1l0yc2: 1l0y C:118-244

Lineage for d1l0yc2 (1l0y C:118-244)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)

8. Domain d1l0yc2: 1l0y C:118-244 [73445]
   Other proteins in same PDB: d1l0ya1, d1l0yb1, d1l0yb2, d1l0yc1, d1l0yd1, d1l0yd2
   complexed with cry, zn; mutant

Details for d1l0yc2

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

SCOP Domain Sequences for d1l0yc2:

Sequence; same for both SEQRES and ATOM records:

>d1l0yc2 b.1.1.2 (C:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

Timeline for d1l0yc2:

• d1l0yc2 first appeared in SCOP 1.61
  
• d1l0yc2 appears in SCOP 1.65
  
• d1l0yc2 appears in the current release, SCOPe 2.08