SCOP 1.75: Domain d1l0yb2: 1l0y B:108-220

Lineage for d1l0yb2 (1l0y B:108-220)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
   Uniprot P08095

8. Domain d1l0yb2: 1l0y B:108-220 [73443]
   Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb1, d1l0yc1, d1l0yc2, d1l0yd1

Details for d1l0yb2

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

PDB Compounds: (B:) exotoxin type a

SCOP Domain Sequences for d1l0yb2:

Sequence; same for both SEQRES and ATOM records:

>d1l0yb2 d.15.6.1 (B:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

Timeline for d1l0yb2:

• d1l0yb2 first appeared in SCOP 1.61
  
• d1l0yb2 appears in SCOP 1.73
  
• d1l0yb2 appears in SCOPe 2.01
  
• d1l0yb2 appears in the current release, SCOPe 2.08