SCOPe 2.03: Domain d1l0yb1: 1l0y B:1-107

Lineage for d1l0yb1 (1l0y B:1-107)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
Uniprot P08095
Domain d1l0yb1: 1l0y B:1-107 [73442]
Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2
complexed with gol, zn

Details for d1l0yb1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: T cell receptor beta chain complexed with superantigen SpeA soaked with zinc

PDB Compounds: (B:) exotoxin type a

SCOPe Domain Sequences for d1l0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOPe Domain Coordinates for d1l0yb1:

Click to download the PDB-style file with coordinates for d1l0yb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0yb1: