SCOP 1.75: Domain d1l0yb1: 1l0y B:1-107

Lineage for d1l0yb1 (1l0y B:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
   Uniprot P08095

8. Domain d1l0yb1: 1l0y B:1-107 [73442]
   Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2

Details for d1l0yb1

PDB Entry: 1l0y, 2.5 Å

PDB Description: t cell receptor beta chain complexed with superantigen spea soaked with zinc

PDB Compounds: (B:) exotoxin type a

SCOP Domain Sequences for d1l0yb1:

Sequence; same for both SEQRES and ATOM records:

>d1l0yb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

Timeline for d1l0yb1:

• d1l0yb1 first appeared in SCOP 1.61
  
• d1l0yb1 appears in SCOP 1.73
  
• d1l0yb1 appears in SCOPe 2.01
  
• d1l0yb1 appears in the current release, SCOPe 2.08