Lineage for d1l0yb1 (1l0y B:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463319Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 463320Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
  8. 463325Domain d1l0yb1: 1l0y B:1-107 [73442]
    Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2

Details for d1l0yb1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: T cell receptor beta chain complexed with superantigen SpeA soaked with zinc
PDB Compounds: (B:)

SCOP Domain Sequences for d1l0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOP Domain Coordinates for d1l0yb1:

Click to download the PDB-style file with coordinates for d1l0yb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0yb1: