Lineage for d1l0yb1 (1l0y B:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166656Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 166657Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 166666Domain d1l0yb1: 1l0y B:1-107 [73442]
    Other proteins in same PDB: d1l0ya1, d1l0ya2, d1l0yb2, d1l0yc1, d1l0yc2, d1l0yd2

Details for d1l0yb1

PDB Entry: 1l0y (more details), 2.5 Å

PDB Description: T cell receptor beta chain complexed with superantigen SpeA soaked with zinc

SCOP Domain Sequences for d1l0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0yb1 b.40.2.2 (B:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOP Domain Coordinates for d1l0yb1:

Click to download the PDB-style file with coordinates for d1l0yb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0yb1: