Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
Domain d1l0ya2: 1l0y A:118-244 [73441] Other proteins in same PDB: d1l0ya1, d1l0yb1, d1l0yb2, d1l0yc1, d1l0yd1, d1l0yd2 |
PDB Entry: 1l0y (more details), 2.5 Å
SCOP Domain Sequences for d1l0ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ya2 b.1.1.2 (A:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgr
Timeline for d1l0ya2: