Lineage for d1l0xd2 (1l0x D:108-221)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179795Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 2179796Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 2179816Domain d1l0xd2: 1l0x D:108-221 [73439]
    Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1
    complexed with gol

Details for d1l0xd2

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea
PDB Compounds: (D:) exotoxin type a

SCOPe Domain Sequences for d1l0xd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xd2 d.15.6.1 (D:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOPe Domain Coordinates for d1l0xd2:

Click to download the PDB-style file with coordinates for d1l0xd2.
(The format of our PDB-style files is described here.)

Timeline for d1l0xd2: