SCOPe 2.08: Domain d1l0xd2: 1l0x D:108-221

Lineage for d1l0xd2 (1l0x D:108-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
   Uniprot P08095

8. Domain d1l0xd2: 1l0x D:108-221 [73439]
   Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1
   complexed with gol

Details for d1l0xd2

PDB Entry: 1l0x, 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea

PDB Compounds: (D:) exotoxin type a

SCOPe Domain Sequences for d1l0xd2:

Sequence; same for both SEQRES and ATOM records:

>d1l0xd2 d.15.6.1 (D:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

Timeline for d1l0xd2:

• d1l0xd2 first appeared in SCOP 1.61
  
• d1l0xd2 appears in SCOPe 2.07