Lineage for d1l0xd1 (1l0x D:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1540933Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 1540934Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 1540954Domain d1l0xd1: 1l0x D:1-107 [73438]
    Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb2, d1l0xc1, d1l0xc2, d1l0xd2
    complexed with gol

Details for d1l0xd1

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: tcr beta chain complexed with streptococcal superantigen spea
PDB Compounds: (D:) exotoxin type a

SCOPe Domain Sequences for d1l0xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xd1 b.40.2.2 (D:1-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhe

SCOPe Domain Coordinates for d1l0xd1:

Click to download the PDB-style file with coordinates for d1l0xd1.
(The format of our PDB-style files is described here.)

Timeline for d1l0xd1: