Lineage for d1l0xb2 (1l0x B:108-221)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 500044Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 500045Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
  8. 500064Domain d1l0xb2: 1l0x B:108-221 [73435]
    Other proteins in same PDB: d1l0xa1, d1l0xa2, d1l0xb1, d1l0xc1, d1l0xc2, d1l0xd1

Details for d1l0xb2

PDB Entry: 1l0x (more details), 2.8 Å

PDB Description: TCR beta chain complexed with streptococcal superantigen SpeA
PDB Compounds: (B:)

SCOP Domain Sequences for d1l0xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0xb2 d.15.6.1 (B:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOP Domain Coordinates for d1l0xb2:

Click to download the PDB-style file with coordinates for d1l0xb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0xb2: