SCOP 1.71: Domain d1l0xa2: 1l0x A:118-244

Lineage for d1l0xa2 (1l0x A:118-244)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)

8. Domain d1l0xa2: 1l0x A:118-244 [73433]
   Other proteins in same PDB: d1l0xa1, d1l0xb1, d1l0xb2, d1l0xc1, d1l0xd1, d1l0xd2

Details for d1l0xa2

PDB Entry: 1l0x, 2.8 Å

PDB Description: TCR beta chain complexed with streptococcal superantigen SpeA

SCOP Domain Sequences for d1l0xa2:

Sequence; same for both SEQRES and ATOM records:

>d1l0xa2 b.1.1.2 (A:118-244) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgr

Timeline for d1l0xa2:

• d1l0xa2 first appeared in SCOP 1.61
  
• d1l0xa2 appears in SCOP 1.69
  
• d1l0xa2 appears in SCOP 1.73
  
• d1l0xa2 appears in the current release, SCOPe 2.07