Lineage for d1l0vo_ (1l0v O:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201945Family f.2.1.9: Fumarate reductase respiratory complex transmembrane subunits [56910] (1 protein)
  6. 201946Protein Fumarate reductase respiratory complex transmembrane subunits [56911] (2 species)
  7. 201947Species Escherichia coli [TaxId:562] [56912] (3 PDB entries)
  8. 201954Domain d1l0vo_: 1l0v O: [73424]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb1, d1l0vb2, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vn2

Details for d1l0vo_

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules

SCOP Domain Sequences for d1l0vo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vo_ f.2.1.9 (O:) Fumarate reductase respiratory complex transmembrane subunits {Escherichia coli}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOP Domain Coordinates for d1l0vo_:

Click to download the PDB-style file with coordinates for d1l0vo_.
(The format of our PDB-style files is described here.)

Timeline for d1l0vo_: