Lineage for d1l0vn1 (1l0v N:106-243)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 149177Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
  5. 149178Family a.1.2.1: Fumarate reductase iron-sulfur protein, C-terminal domain [46549] (1 protein)
  6. 149179Protein Fumarate reductase iron-sulfur protein, C-terminal domain [46550] (2 species)
  7. 149180Species Escherichia coli [TaxId:562] [46551] (3 PDB entries)
  8. 149184Domain d1l0vn1: 1l0v N:106-243 [73422]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn2, d1l0vo_, d1l0vp_

Details for d1l0vn1

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules

SCOP Domain Sequences for d1l0vn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vn1 a.1.2.1 (N:106-243) Fumarate reductase iron-sulfur protein, C-terminal domain {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1l0vn1:

Click to download the PDB-style file with coordinates for d1l0vn1.
(The format of our PDB-style files is described here.)

Timeline for d1l0vn1: