Lineage for d1l0vm2 (1l0v M:0-225,M:358-442)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176345Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 176374Protein Fumarate reductase flavoprotein subunit [51937] (2 species)
  7. 176375Species Escherichia coli [TaxId:562] [51938] (3 PDB entries)
  8. 176379Domain d1l0vm2: 1l0v M:0-225,M:358-442 [73420]
    Other proteins in same PDB: d1l0va1, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_, d1l0vp_

Details for d1l0vm2

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules

SCOP Domain Sequences for d1l0vm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vm2 c.3.1.4 (M:0-225,M:358-442) Fumarate reductase flavoprotein subunit {Escherichia coli}
mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdXmggietdqncetr
ikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagngneaaieaqaa
gveqrlkdlvnq

SCOP Domain Coordinates for d1l0vm2:

Click to download the PDB-style file with coordinates for d1l0vm2.
(The format of our PDB-style files is described here.)

Timeline for d1l0vm2: