Lineage for d1l0gb_ (1l0g B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949301Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1949342Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)
  8. 1949372Domain d1l0gb_: 1l0g B: [73401]
    complexed with po4, suc; mutant

Details for d1l0gb_

PDB Entry: 1l0g (more details), 1.5 Å

PDB Description: X-ray Crystal Structure of AmpC S64G Mutant beta-Lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1l0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0gb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
gvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d1l0gb_:

Click to download the PDB-style file with coordinates for d1l0gb_.
(The format of our PDB-style files is described here.)

Timeline for d1l0gb_: