Lineage for d1l0eb_ (1l0e B:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein AMPC beta-Lactamase, class C [56618] (3 species) Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (24 PDB entries) 
Domain d1l0eb_: 1l0e B: [73397]
Details for d1l0eb_
PDB Entry: 1l0e (more details), 1.9 Å
PDB Description: x-ray crystal structure of ampc k67q mutant beta-lactamase
SCOP Domain Sequences for d1l0eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0eb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsqtftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
SCOP Domain Coordinates for d1l0eb_:
Click to download the PDB-style file with coordinates for d1l0eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l0eb_:
- d1l0eb_ is new in SCOP 1.61
- d1l0eb_ appears in SCOP 1.63
- d1l0eb_ appears in the current release, SCOPe 2.08
View in 3D
