SCOP 1.73: Domain d1l0db_: 1l0d B:

Lineage for d1l0db_ (1l0d B:)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries)

8. Domain d1l0db_: 1l0d B: [73395]
   complexed with po4; mutant

Details for d1l0db_

PDB Entry: 1l0d, 1.53 Å

PDB Description: x-ray crystal structure of ampc s64d mutant beta-lactamase

PDB Compounds: (B:) Beta-lactamase

SCOP Domain Sequences for d1l0db_:

Sequence; same for both SEQRES and ATOM records:

>d1l0db_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
dvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1l0db_:

• d1l0db_ first appeared in SCOP 1.61
  
• d1l0db_ appears in SCOP 1.71
  
• d1l0db_ appears in SCOP 1.75
  
• d1l0db_ appears in the current release, SCOPe 2.08