![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein CDC42 [52619] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries) |
![]() | Domain d1kz7d_: 1kz7 D: [73338] Other proteins in same PDB: d1kz7a1, d1kz7a2, d1kz7c1, d1kz7c2 complexed with mse; mutant |
PDB Entry: 1kz7 (more details), 2.4 Å
SCOP Domain Sequences for d1kz7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kz7d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens)} mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
Timeline for d1kz7d_: