Lineage for d1kz7c1 (1kz7 C:1624-1818)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719565Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 2719566Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
    Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 2719568Domain d1kz7c1: 1kz7 C:1624-1818 [73336]
    Other proteins in same PDB: d1kz7a2, d1kz7b_, d1kz7c2, d1kz7d_

Details for d1kz7c1

PDB Entry: 1kz7 (more details), 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42
PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1kz7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz7c1 a.87.1.1 (C:1624-1818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOPe Domain Coordinates for d1kz7c1:

Click to download the PDB-style file with coordinates for d1kz7c1.
(The format of our PDB-style files is described here.)

Timeline for d1kz7c1: