Lineage for d1kyqb2 (1kyq B:151-273)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954554Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 1954555Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (1 family) (S)
  5. 1954556Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)
  6. 1954557Protein Bifunctional dehydrogenase/ferrochelatase Met8p, dimerisation and C-terminal domains [75617] (1 species)
    involved in siroheme synthesis
  7. 1954558Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75618] (1 PDB entry)
  8. 1954560Domain d1kyqb2: 1kyq B:151-273 [73284]
    Other proteins in same PDB: d1kyqa1, d1kyqb1, d1kyqc1
    complexed with nad

Details for d1kyqb2

PDB Entry: 1kyq (more details), 2.2 Å

PDB Description: Met8p: A bifunctional NAD-dependent dehydrogenase and ferrochelatase involved in siroheme synthesis.
PDB Compounds: (B:) Siroheme biosynthesis protein MET8

SCOPe Domain Sequences for d1kyqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyqb2 e.37.1.1 (B:151-273) Bifunctional dehydrogenase/ferrochelatase Met8p, dimerisation and C-terminal domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ganleigdrlqilistnglsprfgalvrdeirnlftqmgdlaledavvklgelrrgirll
apddkdvkyrmdwarrctdlfgiqhchnidvkrlldlfkvmfqeqncslqfpprerllse
ycs

SCOPe Domain Coordinates for d1kyqb2:

Click to download the PDB-style file with coordinates for d1kyqb2.
(The format of our PDB-style files is described here.)

Timeline for d1kyqb2: