Lineage for d1kyou_ (1kyo U:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158416Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (2 PDB entries)
  8. 158421Domain d1kyou_: 1kyo U: [73277]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyow_

Details for d1kyou_

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyou_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyou_ b.1.1.1 (U:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

SCOP Domain Coordinates for d1kyou_:

Click to download the PDB-style file with coordinates for d1kyou_.
(The format of our PDB-style files is described here.)

Timeline for d1kyou_: