Lineage for d1kyot1 (1kyo T:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201866Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 201867Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 201868Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64530] (2 PDB entries)
  8. 201889Domain d1kyot1: 1kyo T: [73276]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyod1, d1kyoe1, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyoo1, d1kyop1, d1kyou_, d1kyov_, d1kyow_

Details for d1kyot1

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyot1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyot1 f.2.1.8 (T:) Cytochrome bc1 transmembrane subunits {Baker's yeast (Saccharomyces cerevisiae)}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkaki

SCOP Domain Coordinates for d1kyot1:

Click to download the PDB-style file with coordinates for d1kyot1.
(The format of our PDB-style files is described here.)

Timeline for d1kyot1: