Lineage for d1kyol1 (1kyo L:27-239)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2237728Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2237729Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 2237730Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 2237749Domain d1kyol1: 1kyo L:27-239 [73264]
    Other proteins in same PDB: d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
    complexed with fes, hem, sma

Details for d1kyol1

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (L:) ubiquinol-cytochrome c reductase complex core protein I

SCOPe Domain Sequences for d1kyol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyol1 d.185.1.1 (L:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
vvgtgnikhedlvnsiesknlslqtgtkpvlkk

SCOPe Domain Coordinates for d1kyol1:

Click to download the PDB-style file with coordinates for d1kyol1.
(The format of our PDB-style files is described here.)

Timeline for d1kyol1: