Lineage for d1kyol1 (1kyo L:27-239)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199433Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 199434Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (2 PDB entries)
  8. 199439Domain d1kyol1: 1kyo L:27-239 [73264]
    Other proteins in same PDB: d1kyob1, d1kyob2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyoj_, d1kyok_, d1kyom1, d1kyom2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyou_, d1kyov_, d1kyow_

Details for d1kyol1

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyol1 d.185.1.1 (L:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae)}
aevtqlsngivvatehnpahtasvgvvfgsgaanenpynngvsnlwkniflskensavaa
keglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlkq
vqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsnav
vvgtgnikhedlvnsiesknlslqtgtkpvlkk

SCOP Domain Coordinates for d1kyol1:

Click to download the PDB-style file with coordinates for d1kyol1.
(The format of our PDB-style files is described here.)

Timeline for d1kyol1:

199439
d1kyol1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1kyol2