Details for d1kyoh_

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (H:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1kyoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyoh_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOP Domain Coordinates for d1kyoh_:

Click to download the PDB-style file with coordinates for d1kyoh_.
(The format of our PDB-style files is described here.)

Timeline for d1kyoh_: