Lineage for d1kyob2 (1kyo B:219-368)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199430Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 199431Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 199432Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 199457Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 199458Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (2 PDB entries)
  8. 199462Domain d1kyob2: 1kyo B:219-368 [73252]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyou_, d1kyov_, d1kyow_

Details for d1kyob2

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyob2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae)}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

SCOP Domain Coordinates for d1kyob2:

Click to download the PDB-style file with coordinates for d1kyob2.
(The format of our PDB-style files is described here.)

Timeline for d1kyob2: