Lineage for d1kyin_ (1kyi N:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1044730Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1044782Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 1044802Domain d1kyin_: 1kyi N: [73236]
    Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_
    complexed with atp, lvs

Details for d1kyin_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex
PDB Compounds: (N:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1kyin_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyin_ d.153.1.4 (N:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOPe Domain Coordinates for d1kyin_:

Click to download the PDB-style file with coordinates for d1kyin_.
(The format of our PDB-style files is described here.)

Timeline for d1kyin_: