Lineage for d1kyig_ (1kyi G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988530Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2988594Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 2988607Domain d1kyig_: 1kyi G: [73229]
    Other proteins in same PDB: d1kyia_, d1kyib_, d1kyic_, d1kyid_, d1kyie_, d1kyif_, d1kyis_, d1kyit_, d1kyiu_, d1kyiv_, d1kyiw_, d1kyix_
    complexed with atp, lvs

Details for d1kyig_

PDB Entry: 1kyi (more details), 3.1 Å

PDB Description: HslUV (H. influenzae)-NLVS Vinyl Sulfone Inhibitor Complex
PDB Compounds: (G:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1kyig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyig_ d.153.1.4 (G:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOPe Domain Coordinates for d1kyig_:

Click to download the PDB-style file with coordinates for d1kyig_.
(The format of our PDB-style files is described here.)

Timeline for d1kyig_: