Lineage for d1ky3a_ (1ky3 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein Rab-related protein ypt7p [75199] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75200] (2 PDB entries) 
Domain d1ky3a_: 1ky3 A: [73193]
Details for d1ky3a_
PDB Entry: 1ky3 (more details), 1.35 Å
PDB Description: gdp-bound ypt7p at 1.35 a resolution
SCOP Domain Sequences for d1ky3a_:
Sequence, based on SEQRES records: (download)
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae)}
nilkviilgdsgvgktslmhryvndkysqqykatigadfltkevtvdgdkvatmqvwdta
gqerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgn
kidaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq
Sequence, based on observed residues (ATOM records): (download)
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae)}
nilkviilgdsgvgktslmhryvndkysqqyigadfltkevtvdgdkvatmqvwdtaafy
rgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkidaeeskkivse
ksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq
SCOP Domain Coordinates for d1ky3a_:
Click to download the PDB-style file with coordinates for d1ky3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ky3a_:
- d1ky3a_ is new in SCOP 1.61
- d1ky3a_ appears in SCOP 1.63
- d1ky3a_ appears in the current release, SCOPe 2.08
View in 3D