SCOP 1.73: Domain d1kxvd_: 1kxv D:

Lineage for d1kxvd_ (1kxv D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)

8. Domain d1kxvd_: 1kxv D: [73191]
   Other proteins in same PDB: d1kxva1, d1kxva2, d1kxvb1, d1kxvb2
   VHh CAB10 against alpha-amylase

Details for d1kxvd_

PDB Entry: 1kxv, 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

PDB Compounds: (D:) camelid vhh domain cab10

SCOP Domain Sequences for d1kxvd_:

Sequence; same for both SEQRES and ATOM records:

>d1kxvd_ b.1.1.1 (D:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
s

Timeline for d1kxvd_:

• d1kxvd_ first appeared in SCOP 1.61
  
• d1kxvd_ appears in SCOP 1.71
  
• d1kxvd_ appears in SCOP 1.75
  
• d1kxvd_ appears in the current release, SCOPe 2.08