Lineage for d1kxvb2 (1kxv B:1-403)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305662Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 305693Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 305713Species Pig (Sus scrofa) [TaxId:9823] [51459] (11 PDB entries)
  8. 305720Domain d1kxvb2: 1kxv B:1-403 [73189]
    Other proteins in same PDB: d1kxva1, d1kxvb1, d1kxvc_, d1kxvd_

Details for d1kxvb2

PDB Entry: 1kxv (more details), 1.6 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase

SCOP Domain Sequences for d1kxvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxvb2 c.1.8.1 (B:1-403) Animal alpha-amylase {Pig (Sus scrofa)}
qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOP Domain Coordinates for d1kxvb2:

Click to download the PDB-style file with coordinates for d1kxvb2.
(The format of our PDB-style files is described here.)

Timeline for d1kxvb2: