Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Camel (Camelus dromedarius), VHH against alpha-amylase [74821] (1 PDB entry) |
Domain d1kxtf_: 1kxt F: [73185] Other proteins in same PDB: d1kxta1, d1kxta2, d1kxtc1, d1kxtc2, d1kxte1, d1kxte2 complexed with ca, cl |
PDB Entry: 1kxt (more details), 2 Å
SCOP Domain Sequences for d1kxtf_:
Sequence, based on SEQRES records: (download)
>d1kxtf_ b.1.1.1 (F:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH against alpha-amylase} qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg tqvtv
>d1kxtf_ b.1.1.1 (F:) Immunoglobulin (variable domains of L and H chains) {Camel (Camelus dromedarius), VHH against alpha-amylase} qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq vtv
Timeline for d1kxtf_: