Lineage for d1kxtd_ (1kxt D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 651999Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)
  7. 652000Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)
  8. 652015Domain d1kxtd_: 1kxt D: [73182]
    Other proteins in same PDB: d1kxta1, d1kxta2, d1kxtc1, d1kxtc2, d1kxte1, d1kxte2

Details for d1kxtd_

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (D:) immunoglobulin vhh fragment

SCOP Domain Sequences for d1kxtd_:

Sequence, based on SEQRES records: (download)

>d1kxtd_ b.1.1.1 (D:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
tqvtv

Sequence, based on observed residues (ATOM records): (download)

>d1kxtd_ b.1.1.1 (D:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads
vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq
vtv

SCOP Domain Coordinates for d1kxtd_:

Click to download the PDB-style file with coordinates for d1kxtd_.
(The format of our PDB-style files is described here.)

Timeline for d1kxtd_: