Lineage for d1kxtc2 (1kxt C:1-403)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 969863Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 969903Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 969948Species Pig (Sus scrofa) [TaxId:9823] [51459] (14 PDB entries)
  8. 969963Domain d1kxtc2: 1kxt C:1-403 [73181]
    Other proteins in same PDB: d1kxta1, d1kxtb_, d1kxtc1, d1kxtd_, d1kxte1, d1kxtf_
    complexed with ca, cl

Details for d1kxtc2

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (C:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1kxtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxtc2 c.1.8.1 (C:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOPe Domain Coordinates for d1kxtc2:

Click to download the PDB-style file with coordinates for d1kxtc2.
(The format of our PDB-style files is described here.)

Timeline for d1kxtc2: