Lineage for d1kxtc1 (1kxt C:404-496)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566046Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 566074Protein Animal alpha-amylase [51024] (3 species)
  7. 566103Species Pig (Sus scrofa) [TaxId:9823] [51025] (12 PDB entries)
  8. 566115Domain d1kxtc1: 1kxt C:404-496 [73180]
    Other proteins in same PDB: d1kxta2, d1kxtb_, d1kxtc2, d1kxtd_, d1kxte2, d1kxtf_

Details for d1kxtc1

PDB Entry: 1kxt (more details), 2 Å

PDB Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
PDB Compounds: (C:)

SCOP Domain Sequences for d1kxtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxtc1 b.71.1.1 (C:404-496) Animal alpha-amylase {Pig (Sus scrofa)}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kxtc1:

Click to download the PDB-style file with coordinates for d1kxtc1.
(The format of our PDB-style files is described here.)

Timeline for d1kxtc1: