Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries) SQ NA # camelid antibody |
Domain d1kxtb_: 1kxt B: [73179] Other proteins in same PDB: d1kxta1, d1kxta2, d1kxtc1, d1kxtc2, d1kxte1, d1kxte2 VHh against alpha-amylase complexed with ca, cl |
PDB Entry: 1kxt (more details), 2 Å
SCOPe Domain Sequences for d1kxtb_:
Sequence, based on SEQRES records: (download)
>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg tqvtv
>d1kxtb_ b.1.1.1 (B:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvasgggsvqaggslrlscaastfssypmgwyrqapgkecelsarifsdgsanyads vkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqgtq vtv
Timeline for d1kxtb_: